Submit a Review & Earn an Amazon Gift Card
You can now submit reviews for your favorite Tocris products. Your review will help other researchers decide on the best products for their research. Why not submit a review today?!
Submit ReviewParathyroid hormone (1-34) (rat)
Description: Parathyroid hormone (PTH) receptor agonist
Purity: ≥95% (HPLC)
Biological Activity for Parathyroid hormone (1-34) (rat)
Parathyroid hormone (1-34) (rat) is a parathyroid hormone (PTH) receptor agonist. Increases serum PTH levels and bone mass in rats.
Technical Data for Parathyroid hormone (1-34) (rat)
| M. Wt | 4057.74 |
| Formula | C180H291N55O48S2 |
| Sequence | AVSEIQLMHNLGKHLASVERMQWLRKKLQDVHNF |
| Storage | Store at -20°C |
| Purity | ≥95% (HPLC) |
| CAS Number | 98614-76-7 |
| PubChem ID | 16201228 |
| InChI Key | QSJWQIQDNBBZSH-NEAXTQLLSA-N |
| Smiles | [H]N[C@@H](C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C)C(=O)N[C@@H](CO)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC1=CNC2=C1C=CC=C2)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(O)=O |
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.
Solubility Data for Parathyroid hormone (1-34) (rat)
| Solubility | Soluble to 1 mg/ml in water |
Product Datasheets for Parathyroid hormone (1-34) (rat)
References for Parathyroid hormone (1-34) (rat)
References are publications that support the biological activity of the product.
Lymperi et al (2017) Inhibition of osteoclast function reduces hematopoietic stem cell numbers in vivo. Blood. 117 1540 PMID: 21131587
If you know of a relevant reference for Parathyroid hormone (1-34) (rat), please let us know.
View Related Products by Target
View Related Products by Product Action
Keywords: Parathyroid hormone (1-34) (rat), Parathyroid hormone (1-34) (rat) supplier, Parathyroid, hormone, (1-34), rat, PTH, agonists, agonism, increases, bone, mass, Hormone, Receptors, 6301, Tocris Bioscience
Citations for Parathyroid hormone (1-34) (rat)
Citations are publications that use Tocris products.
Currently there are no citations for Parathyroid hormone (1-34) (rat). Do you know of a great paper that uses Parathyroid hormone (1-34) (rat) from Tocris? Please let us know.
Reviews for Parathyroid hormone (1-34) (rat)
There are currently no reviews for this product. Be the first to review Parathyroid hormone (1-34) (rat) and earn rewards!
Have you used Parathyroid hormone (1-34) (rat)?
Submit a review and receive an Amazon gift card.
$50/€35/£30/$50CAN/¥300 Yuan/¥5000 Yen for first to review with an image
$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image
$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image