Submit a Review & Earn an Amazon Gift Card
You can now submit reviews for your favorite Tocris products. Your review will help other researchers decide on the best products for their research. Why not submit a review today?!
Submit ReviewPeptide YY (3-36) human is a NPY Y2 receptor agonist. Peripheral administration inhibits food intake in mice. This effect is greater when Peptide YY (3-36) is administered in combination with GLP-1 (7-36) (Cat.No. 2082).
M. Wt | 4049.51 |
Formula | C180H279N53O54 |
Sequence |
IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY (Modifications: Tyr-34 = C-terminal amide) |
Storage | Store at -20°C |
Purity | ≥95% (HPLC) |
CAS Number | 123583-37-9 |
PubChem ID | 71581482 |
InChI Key | AUHJXHCVECGTKR-RIBGVNDISA-N |
Smiles | [H]N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCCCN)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(=O)N1CCC[C@H]1C(=O)NCC(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CO)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(N)=O |
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.
References are publications that support the biological activity of the product.
Batterham et al (2002) Gut hormone PYY(3-36) physiologically inhibits food intake. Nature 418 650 PMID: 12167864
Neary et al (2005) Peptide YY3-36 and glucagon-like peptide-17-36 inhibit food intake additively Endocrinology. 146 5120 PMID: 16150917
Keywords: Peptide YY (3-36) human, Peptide YY (3-36) human supplier, Peptide, YY, human, neuropeptide, Y2, NPY, receptor, PYY, agonists, agonism, Receptors, 6288, Tocris Bioscience
Citations are publications that use Tocris products.
Currently there are no citations for Peptide YY (3-36) human.
There are currently no reviews for this product. Be the first to review Peptide YY (3-36) human and earn rewards!
$50/€35/£30/$50CAN/¥300 Yuan/¥5000 Yen for first to review with an image
$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image
$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image
Tocris offers the following scientific literature in this area to showcase our products. We invite you to request* your copy today!
*Please note that Tocris will only send literature to established scientific business / institute addresses.
Written by Sonia Tucci, Lynsay Kobelis and Tim Kirkham, this review provides a synopsis of the increasing number of peptides that have been implicated in appetite regulation and energy homeostasis; putative roles of the major peptides are outlined and compounds available from Tocris are listed.