Amyloid β-Peptide (1-40) (human)

Pricing Availability   Qty
Description: Amyloid β-protein fragment
Purity: ≥95% (HPLC)
Datasheet
Citations (1)
Reviews
Literature (1)

Biological Activity for Amyloid β-Peptide (1-40) (human)

Amyloid β-Peptide (1-40) (human) is a peptide found in plaques in the brains of patients with Alzheimer's disease. Shown to have both neurotrophic and neurotoxic effects.

Technical Data for Amyloid β-Peptide (1-40) (human)

M. Wt 4329.86
Formula C194H295N53O58S
Sequence DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Storage Store at -20°C
Purity ≥95% (HPLC)
CAS Number 131438-79-4
PubChem ID 16135555
InChI Key FEWOUVRMGWFWIH-ILZZQXMPSA-N
Smiles [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)NCC(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)CC)C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](C(C)C)C(=O)NCC(=O)NCC(=O)N[C@@H](C(C)C)C(=O)N[C@@H](C(C)C)C(O)=O

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.

Tocris products are intended for laboratory research use only, unless stated otherwise.

Solubility Data for Amyloid β-Peptide (1-40) (human)

Solubility Soluble to 1 mg/ml in water

Product Datasheets for Amyloid β-Peptide (1-40) (human)

Certificate of Analysis / Product Datasheet
Select another batch:

References for Amyloid β-Peptide (1-40) (human)

References are publications that support the biological activity of the product.

Cleary et al (1995) Beta-amyloid(1-40) effects on behavior and memory. Brain Res. 682 69 PMID: 7552329

Kowalska and Badellino (1994) β-Amyloid protein induces platelet aggregation and supports platelet adhesion. Biochem.Biophys.Res.Commun. 205 1829 PMID: 7811271

Miguel-Hidalgo and Cacabelos (1998) Beta-amyloid(1-40)-induced neurodegeneration in the rat hippocampal neurons of the CA1 subfield. Acta Neuropathol. 95 455 PMID: 9600591

Yankner et al (1990) Neurotrophic and neurotoxic effects of amyloid β protein: reversal by tachykinin neuropeptides. Science 250 279 PMID: 2218531


If you know of a relevant reference for Amyloid β-Peptide (1-40) (human), please let us know.

View Related Products by Target

Keywords: Amyloid beta-Peptide (1-40) (human), Amyloid beta-Peptide (1-40) (human) supplier, Amyloid, β-protein, beta-protein, fragment, Precursor, Protein, APP, Secretase, β-peptide, beta-peptides, b-peptides, b-amyloid, β-Amyloid, beta-Amyloid, amyloid, beta-peptide, (1-40), (human), amyloidbeta, amyloidb, amyloidβ, Beta, Peptides, 1191, Tocris Bioscience

1 Citation for Amyloid β-Peptide (1-40) (human)

Citations are publications that use Tocris products. Selected citations for Amyloid β-Peptide (1-40) (human) include:

Briyal et al (2015) Stimulation of endothelin B receptors by IRL-1620 decreases the progression of Alzheimer's disease. Neuroscience 301 1 PMID: 26022359


Do you know of a great paper that uses Amyloid β-Peptide (1-40) (human) from Tocris? Please let us know.

Reviews for Amyloid β-Peptide (1-40) (human)

There are currently no reviews for this product. Be the first to review Amyloid β-Peptide (1-40) (human) and earn rewards!

Have you used Amyloid β-Peptide (1-40) (human)?

Submit a review and receive an Amazon gift card.

$50/€35/£30/$50CAN/¥300 Yuan/¥5000 Yen for first to review with an image

$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review

Literature in this Area

Tocris offers the following scientific literature in this area to showcase our products. We invite you to request* your copy today!

*Please note that Tocris will only send literature to established scientific business / institute addresses.


Alzheimer's Disease Poster

Alzheimer's Disease Poster

Alzheimer's disease (AD) is a debilitating and progressive neurodegenerative disease and the most common cause of dementia, affecting approximately 30% of individuals aged over 85 years. This poster summarizes the cellular and molecular mechanisms of AD.