Submit a Review & Earn an Amazon Gift Card
You can now submit reviews for your favorite Tocris products. Your review will help other researchers decide on the best products for their research. Why not submit a review today?!
Submit ReviewAmyloid β-peptide (1-40) (rat)
Discontinued Product
2424 has been discontinued.
Description: Amyloid β-protein fragment
Biological Activity for Amyloid β-peptide (1-40) (rat)
Amyloid β-peptide (1-40) (rat) is a rat form of the amyloid β-peptide found in plaques associated with Alzheimer's disease. Shown to have both neurotrophic and neurotoxic effects.
Technical Data for Amyloid β-peptide (1-40) (rat)
| M. Wt | 4233.76 |
| Formula | C190H291N51O57S |
| Sequence | DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV |
| Storage | Desiccate at -20°C |
| CAS Number | 144409-98-3 |
| PubChem ID | 90488761 |
| InChI Key | HAWSUONKNKRLRH-QSLPLQOHSA-N |
| Smiles | [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)NCC(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)NCC(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)CC)C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](C(C)C)C(=O)NCC(=O)NCC(=O)N[C@@H](C(C)C)C(=O)N[C@@H](C(C)C)C(O)=O |
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.
Product Datasheets for Amyloid β-peptide (1-40) (rat)
References for Amyloid β-peptide (1-40) (rat)
References are publications that support the biological activity of the product.
Yankner et al (1990) Neurotrophic and neurotoxic effects of amyloid beta protein: reversal by tachykinin neuropeptides. Science 250 279 PMID: 2218531
Cleary et al (1995) Beta-amyloid(1-40) effects on behavior and memory. Brain Res. 682 69 PMID: 7552329
Miguel-Hidalgo and Cacabelos (1998) Beta-amyloid(1-40)-induced neurodegeneration in the rat hippocampal neurons of the CA1 subfield. Acta Neuropathol. 95 455 PMID: 9600591
Kowalska and Badellino (1994) β-Amyloid protein induces platelet aggregation and supports platelet adhesion. Biochem.Biophys.Res.Comm. 205 1829
View Related Products by Target
Keywords: Amyloid beta-peptide (1-40) (rat), Amyloid beta-peptide (1-40) (rat) supplier, Amyloid, β-protein, beta-protein, fragment, β-Amyloid, beta-Amyloid, b-amyloid, Precursor, Protein, APP, Secretase, beta, Peptides, β-peptide, beta-peptide, 1-40, (rat), amyloidbeta, amyloidb, amyloidβ, Beta, 2424, Tocris Bioscience
Citations for Amyloid β-peptide (1-40) (rat)
Citations are publications that use Tocris products.
Currently there are no citations for Amyloid β-peptide (1-40) (rat).
Reviews for Amyloid β-peptide (1-40) (rat)
There are currently no reviews for this product. Be the first to review Amyloid β-peptide (1-40) (rat) and earn rewards!
Have you used Amyloid β-peptide (1-40) (rat)?
Submit a review and receive an Amazon gift card.
$50/€35/£30/$50CAN/¥300 Yuan/¥5000 Yen for first to review with an image
$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image
$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image
Literature in this Area
Tocris offers the following scientific literature in this area to showcase our products. We invite you to request* your copy today!
*Please note that Tocris will only send literature to established scientific business / institute addresses.
Alzheimer's Disease Poster
Alzheimer's disease (AD) is a debilitating and progressive neurodegenerative disease and the most common cause of dementia, affecting approximately 30% of individuals aged over 85 years. This poster summarizes the cellular and molecular mechanisms of AD.