Submit a Review & Earn an Amazon Gift Card
You can now submit reviews for your favorite Tocris products. Your review will help other researchers decide on the best products for their research. Why not submit a review today?!
Submit ReviewNogo-66 (1-40)
Description: Competitive antagonist for Nogo-66 receptor; promotes neuron regeneration
Alternative Names: NEP1-40,Nogo Extracellular Peptide,1-40
Purity: ≥95% (HPLC)
Biological Activity for Nogo-66 (1-40)
Nogo-66 (1-40) is a peptide fragment corresponding to residues 1 - 40 of Nogo-66, the domain of the myelin protein Nogo that inhibits axonal outgrowth. Acts as a competitive antagonist at the Nogo-66 receptor (NgR); blocks Nogo-66- and CNS myelin-induced inhibition of axonal growth, but does not reduce myelin-associated glycoprotein (MAG) inhibition of neurite outgrowth in vitro. Promotes regeneration of hemisected spinal axons and locomotor recovery following spinal injury in vivo.
Technical Data for Nogo-66 (1-40)
| M. Wt | 4625.16 |
| Formula | C206H324N56O65 |
| Sequence |
RIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNS (Modifications: Arg-1 = N-terminal Ac, Ser-40 = C-terminal amide) |
| Storage | Store at -20°C |
| Purity | ≥95% (HPLC) |
| CAS Number | 475221-20-6 |
| PubChem ID | 16142739 |
| InChI Key | OLEKMOOQFWTQGD-SJQNMCRDSA-N |
| Smiles | CC[C@H](C)[C@H](NC(=O)[C@H](C)NC(=O)[C@@H](NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC1=CC=C(O)C=C1)NC(=O)[C@H](C)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC1=CC=CC=C1)NC(=O)[C@@H]1CCCN1C(=O)[C@H](CC1=CNC=N1)NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCCCN)NC(=O)[C@H](CC1=CC=C(O)C=C1)NC(=O)[C@@H](NC(=O)[C@H](CCCNC(N)=N)NC(C)=O)[C@@H](C)CC)C(C)C)[C@@H](C)CC)[C@@H](C)CC)C(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CO)C(N)=O |
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.
Solubility Data for Nogo-66 (1-40)
| Solubility | Soluble to 1 mg/ml in water |
Product Datasheets for Nogo-66 (1-40)
References for Nogo-66 (1-40)
References are publications that support the biological activity of the product.
GrandPre et al (2002) Nogo-66 receptor antagonist peptide promotes axonal regeneration. Nature 417 547 PMID: 12037567
Liu et al (2002) Myelin-associated glycoprotein as a functional ligand for the Nogo-66 receptor. Science 297 1190 PMID: 12089450
Li and Strittmatter (2003) Delayed systemic Nogo-66 receptor antagonist promotes recovery from spinal cord injury. J.Neurosci. 23 4219 PMID: 12764110
If you know of a relevant reference for Nogo-66 (1-40), please let us know.
View Related Products by Target
Keywords: Nogo-66 (1-40), Nogo-66 (1-40) supplier, Competitive, antagonists, Nogo-66, receptor, NGR, neuron, regeneration, NEP140, NEP1-40, Nogo, Extracellular, Peptide,, 1-40, Neuronal, Metabolism, 1984, Tocris Bioscience
Citations for Nogo-66 (1-40)
Citations are publications that use Tocris products.
Currently there are no citations for Nogo-66 (1-40). Do you know of a great paper that uses Nogo-66 (1-40) from Tocris? Please let us know.
Reviews for Nogo-66 (1-40)
There are currently no reviews for this product. Be the first to review Nogo-66 (1-40) and earn rewards!
Have you used Nogo-66 (1-40)?
Submit a review and receive an Amazon gift card.
$50/€35/£30/$50CAN/¥300 Yuan/¥5000 Yen for first to review with an image
$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image
$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image