Submit a Review & Earn an Amazon Gift Card
You can now submit reviews for your favorite Tocris products. Your review will help other researchers decide on the best products for their research. Why not submit a review today?!
Submit ReviewAmyloid β-peptide (42-1) (human)
Discontinued Product
3391 has been discontinued.
Description: Inactive control peptide for amyloid β-peptide (1-42) (Cat. No. 1428)
Purity: ≥95% (HPLC)
Biological Activity for Amyloid β-peptide (42-1) (human)
Amyloid β-peptide (42-1) (human) is an inactive control peptide for amyloid β-peptide (1-42), the predominant form of amyloid β-peptide found in the brains of patients with Alzheimer's disease.
Active Analog also available.
Technical Data for Amyloid β-peptide (42-1) (human)
| M. Wt | 4514.08 |
| Formula | C203H311N55O60S |
| Sequence | AIVVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD |
| Storage | Store at -20°C |
| Purity | ≥95% (HPLC) |
| CAS Number | 317366-82-8 |
| PubChem ID | 16132430 |
| InChI Key | PLOPBXQQPZYQFA-AXPWDRQUSA-N |
| Smiles | [H]N[C@@H](C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](C(C)C)C(=O)NCC(=O)NCC(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)NCC(=O)N[C@@H](CO)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(O)=O)C(O)=O |
The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.
Product Datasheets for Amyloid β-peptide (42-1) (human)
References for Amyloid β-peptide (42-1) (human)
References are publications that support the biological activity of the product.
Walsh et al (2002) Amyloid-beta peotide is toxic to neurons in vivo via indirect mechanisms. Neurobiol.Dis. 10 20 PMID: 12079400
Xiong et al (2007) Mitochondrial respiratory inhibition and oxidative stress elevate β-secretase (BACE1) proteins and activity in vivo in the rat retina. Exp.Brain Res. 181 435 PMID: 17429617
Boyd-Kimball et al (2005) Proteomic identification of proteins oxidized by Aβ(1-42) in synaptosomes: Implications for Alzheimer's disease. Brain Res. 1004 206 PMID: 15885219
View Related Products by Target
Keywords: Amyloid beta-peptide (42-1) (human), Amyloid beta-peptide (42-1) (human) supplier, Inactive, control, peptide, β-Amyloid, beta-Amyloid, b-amyoid, Precursor, Protein, APP, Secretase, beta, Peptides, Amyloid, β-peptide, beta-peptide, (42-1), (human), amyloidbeta, amyloidb, amyloidβ, Beta, 3391, Tocris Bioscience
1 Citation for Amyloid β-peptide (42-1) (human)
Citations are publications that use Tocris products. Selected citations for Amyloid β-peptide (42-1) (human) include:
Esposito et al (2011) Cannabidiol reduces Aβ-induced neuroinflammation and promotes hippocampal neurogenesis through PPARγ involvement. PLoS One 6 e28668 PMID: 22163051
Reviews for Amyloid β-peptide (42-1) (human)
There are currently no reviews for this product. Be the first to review Amyloid β-peptide (42-1) (human) and earn rewards!
Have you used Amyloid β-peptide (42-1) (human)?
Submit a review and receive an Amazon gift card.
$50/€35/£30/$50CAN/¥300 Yuan/¥5000 Yen for first to review with an image
$25/€18/£15/$25CAN/¥75 Yuan/¥2500 Yen for a review with an image
$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image
Literature in this Area
Tocris offers the following scientific literature in this area to showcase our products. We invite you to request* your copy today!
*Please note that Tocris will only send literature to established scientific business / institute addresses.
Alzheimer's Disease Poster
Alzheimer's disease (AD) is a debilitating and progressive neurodegenerative disease and the most common cause of dementia, affecting approximately 30% of individuals aged over 85 years. This poster summarizes the cellular and molecular mechanisms of AD.